Lineage for d1szog_ (1szo G:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980706Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 980707Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 981011Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 981020Protein 6-oxo camphor hydrolase [82331] (1 species)
  7. 981021Species Rhodococcus erythropolis [TaxId:1833] [82332] (2 PDB entries)
    Uniprot Q93TU6
  8. 981028Domain d1szog_: 1szo G: [106170]
    complexed with ca, cax; mutant

Details for d1szog_

PDB Entry: 1szo (more details), 1.9 Å

PDB Description: crystal structure analysis of the 6-oxo camphor hydrolase his122ala mutant bound to its natural product (2s,4s)-alpha-campholinic acid
PDB Compounds: (G:) 6-oxocamphor hydrolase

SCOPe Domain Sequences for d1szog_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szog_ c.14.1.3 (G:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]}
latpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkv
viltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnap
eipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldart
aldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglah
ealaaidlg

SCOPe Domain Coordinates for d1szog_:

Click to download the PDB-style file with coordinates for d1szog_.
(The format of our PDB-style files is described here.)

Timeline for d1szog_: