Lineage for d1szoc_ (1szo C:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480393Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 480394Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 480448Family c.14.1.3: Crotonase-like [52103] (8 proteins)
  6. 480457Protein 6-oxo camphor hydrolase [82331] (1 species)
  7. 480458Species Actinomycete (Rhodococcus erythropolis) [82332] (2 PDB entries)
  8. 480461Domain d1szoc_: 1szo C: [106166]

Details for d1szoc_

PDB Entry: 1szo (more details), 1.9 Å

PDB Description: crystal structure analysis of the 6-oxo camphor hydrolase his122ala mutant bound to its natural product (2s,4s)-alpha-campholinic acid

SCOP Domain Sequences for d1szoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szoc_ c.14.1.3 (C:) 6-oxo camphor hydrolase {Actinomycete (Rhodococcus erythropolis)}
latpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkv
viltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnap
eipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldart
aldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglah
ealaaidl

SCOP Domain Coordinates for d1szoc_:

Click to download the PDB-style file with coordinates for d1szoc_.
(The format of our PDB-style files is described here.)

Timeline for d1szoc_: