![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (4 families) ![]() |
![]() | Family c.14.1.3: Crotonase-like [52103] (8 proteins) |
![]() | Protein 6-oxo camphor hydrolase [82331] (1 species) |
![]() | Species Actinomycete (Rhodococcus erythropolis) [82332] (2 PDB entries) |
![]() | Domain d1szoa_: 1szo A: [106164] |
PDB Entry: 1szo (more details), 1.9 Å
SCOP Domain Sequences for d1szoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Actinomycete (Rhodococcus erythropolis)} latpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkv viltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnap eipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldart aldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglah ealaaidlg
Timeline for d1szoa_: