Lineage for d1szoa_ (1szo A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. Protein 6-oxo camphor hydrolase [82331] (1 species)
  7. Species Rhodococcus erythropolis [TaxId:1833] [82332] (2 PDB entries)
    Uniprot Q93TU6
  8. Domain d1szoa_: 1szo A: [106164]
    complexed with ca, cax; mutant

Details for d1szoa_

PDB Entry: 1szo (more details), 1.9 Å

PDB Description: Crystal Structure Analysis of the 6-Oxo Camphor Hydrolase His122Ala Mutant Bound to Its Natural Product (2S,4S)-alpha-Campholinic Acid
PDB Compounds: (A:) 6-oxocamphor hydrolase

SCOPe Domain Sequences for d1szoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]}
latpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkv
viltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnap
eipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldart
aldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglah
ealaaidlg

SCOPe Domain Coordinates for d1szoa_ are not available.

Timeline for d1szoa_:

Domains from other chains:
(mouse over for more information)
d1szob_, d1szoc_, d1szod_, d1szoe_, d1szof_, d1szog_, d1szoh_, d1szoi_, d1szoj_, d1szok_, d1szol_