![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Melibiase [75020] (4 species) |
![]() | Species Trichoderma reesei [TaxId:51453] [110300] (2 PDB entries) |
![]() | Domain d1szna1: 1szn A:315-417 [106162] Other proteins in same PDB: d1szna2 complexed with gol, man, nag |
PDB Entry: 1szn (more details), 1.54 Å
SCOP Domain Sequences for d1szna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1szna1 b.71.1.1 (A:315-417) Melibiase {Trichoderma reesei} vygqpatpykwginpdwtfnvtypaefwagpsskghlvlmvntlditatkeakwneipgl saghyevrdvwsdkdlgclssykaavaahdtavilvgkkcqrw
Timeline for d1szna1: