Lineage for d1szhb_ (1szh B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2350850Fold a.226: Her-1 [110013] (1 superfamily)
    multihelical; consists of two topologically similar alpha-helical bundles
  4. 2350851Superfamily a.226.1: Her-1 [110014] (1 family) (S)
    automatically mapped to Pfam PF09232
  5. 2350852Family a.226.1.1: Her-1 [110015] (1 protein)
  6. 2350853Protein Her-1 [110016] (1 species)
  7. 2350854Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110017] (1 PDB entry)
    Uniprot P34704
  8. 2350856Domain d1szhb_: 1szh B: [106158]
    Other proteins in same PDB: d1szha2
    complexed with act

Details for d1szhb_

PDB Entry: 1szh (more details), 1.5 Å

PDB Description: crystal structure of c. elegans her-1
PDB Compounds: (B:) Her-1 protein

SCOPe Domain Sequences for d1szhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szhb_ a.226.1.1 (B:) Her-1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ltkelikdaaekcctrnrqeccieimkfgtpircgydrdpklpgyvykclqnvlfakepk
kkinlddsvccsvfgndqedsgrrcenrcknlmtspsidaatrldsikscslldnvlykc
fekcrslrkdgikievlqfeeyc

SCOPe Domain Coordinates for d1szhb_:

Click to download the PDB-style file with coordinates for d1szhb_.
(The format of our PDB-style files is described here.)

Timeline for d1szhb_: