SCOPe 2.06: Domain d1szhb_: 1szh B:

Lineage for d1szhb_ (1szh B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.226: Her-1 [110013] (1 superfamily)
   multihelical; consists of two topologically similar alpha-helical bundles

4. Superfamily a.226.1: Her-1 [110014] (1 family)
   automatically mapped to Pfam PF09232

5. Family a.226.1.1: Her-1 [110015] (1 protein)

6. Protein Her-1 [110016] (1 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110017] (1 PDB entry)
   Uniprot P34704

8. Domain d1szhb_: 1szh B: [106158]
   Other proteins in same PDB: d1szha2
   complexed with act

Details for d1szhb_

PDB Entry: 1szh, 1.5 Å

PDB Description: crystal structure of c. elegans her-1

PDB Compounds: (B:) Her-1 protein

SCOPe Domain Sequences for d1szhb_:

Sequence; same for both SEQRES and ATOM records:

>d1szhb_ a.226.1.1 (B:) Her-1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ltkelikdaaekcctrnrqeccieimkfgtpircgydrdpklpgyvykclqnvlfakepk
kkinlddsvccsvfgndqedsgrrcenrcknlmtspsidaatrldsikscslldnvlykc
fekcrslrkdgikievlqfeeyc

Timeline for d1szhb_:

• d1szhb_ first appeared in SCOP 1.69
  
• d1szhb_ appears in SCOPe 2.05
  
• d1szhb_ appears in SCOPe 2.07
  
• d1szhb_ appears in the current release, SCOPe 2.08