Class a: All alpha proteins [46456] (289 folds) |
Fold a.226: Her-1 [110013] (1 superfamily) multihelical; consists of two topologically similar alpha-helical bundles |
Superfamily a.226.1: Her-1 [110014] (1 family) automatically mapped to Pfam PF09232 |
Family a.226.1.1: Her-1 [110015] (1 protein) |
Protein Her-1 [110016] (1 species) |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110017] (1 PDB entry) Uniprot P34704 |
Domain d1szhb_: 1szh B: [106158] Other proteins in same PDB: d1szha2 complexed with act |
PDB Entry: 1szh (more details), 1.5 Å
SCOPe Domain Sequences for d1szhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1szhb_ a.226.1.1 (B:) Her-1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} ltkelikdaaekcctrnrqeccieimkfgtpircgydrdpklpgyvykclqnvlfakepk kkinlddsvccsvfgndqedsgrrcenrcknlmtspsidaatrldsikscslldnvlykc fekcrslrkdgikievlqfeeyc
Timeline for d1szhb_: