Lineage for d1szhb_ (1szh B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450757Fold a.226: Her-1 [110013] (1 superfamily)
    multihelical; consists of two topologically similar alpha-helical bundles
  4. 450758Superfamily a.226.1: Her-1 [110014] (1 family) (S)
  5. 450759Family a.226.1.1: Her-1 [110015] (1 protein)
  6. 450760Protein Her-1 [110016] (1 species)
  7. 450761Species Caenorhabditis elegans [110017] (1 PDB entry)
  8. 450763Domain d1szhb_: 1szh B: [106158]

Details for d1szhb_

PDB Entry: 1szh (more details), 1.5 Å

PDB Description: crystal structure of c. elegans her-1

SCOP Domain Sequences for d1szhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szhb_ a.226.1.1 (B:) Her-1 {Caenorhabditis elegans}
ltkelikdaaekcctrnrqeccieimkfgtpircgydrdpklpgyvykclqnvlfakepk
kkinlddsvccsvfgndqedsgrrcenrcknlmtspsidaatrldsikscslldnvlykc
fekcrslrkdgikievlqfeeyc

SCOP Domain Coordinates for d1szhb_:

Click to download the PDB-style file with coordinates for d1szhb_.
(The format of our PDB-style files is described here.)

Timeline for d1szhb_: