Lineage for d1szha1 (1szh A:19-164)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2019895Fold a.226: Her-1 [110013] (1 superfamily)
    multihelical; consists of two topologically similar alpha-helical bundles
  4. 2019896Superfamily a.226.1: Her-1 [110014] (1 family) (S)
    automatically mapped to Pfam PF09232
  5. 2019897Family a.226.1.1: Her-1 [110015] (1 protein)
  6. 2019898Protein Her-1 [110016] (1 species)
  7. 2019899Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110017] (1 PDB entry)
    Uniprot P34704
  8. 2019900Domain d1szha1: 1szh A:19-164 [106157]
    Other proteins in same PDB: d1szha2
    complexed with act

Details for d1szha1

PDB Entry: 1szh (more details), 1.5 Å

PDB Description: crystal structure of c. elegans her-1
PDB Compounds: (A:) Her-1 protein

SCOPe Domain Sequences for d1szha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szha1 a.226.1.1 (A:19-164) Her-1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
tltkelikdaaekcctrnrqeccieimkfgtpircgydrdpklpgyvykclqnvlfakep
kkkinlddsvccsvfgndqedsgrrcenrcknlmtspsidaatrldsikscslldnvlyk
cfekcrslrkdgikievlqfeeycea

SCOPe Domain Coordinates for d1szha1:

Click to download the PDB-style file with coordinates for d1szha1.
(The format of our PDB-style files is described here.)

Timeline for d1szha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1szha2
View in 3D
Domains from other chains:
(mouse over for more information)
d1szhb_