SCOPe 2.08: Domain d1szha1: 1szh A:19-164

Lineage for d1szha1 (1szh A:19-164)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.226: Her-1 [110013] (1 superfamily)
   multihelical; consists of two topologically similar alpha-helical bundles

4. Superfamily a.226.1: Her-1 [110014] (1 family)
   automatically mapped to Pfam PF09232

5. Family a.226.1.1: Her-1 [110015] (1 protein)

6. Protein Her-1 [110016] (1 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110017] (1 PDB entry)
   Uniprot P34704

8. Domain d1szha1: 1szh A:19-164 [106157]
   Other proteins in same PDB: d1szha2
   complexed with act

Details for d1szha1

PDB Entry: 1szh, 1.5 Å

PDB Description: crystal structure of c. elegans her-1

PDB Compounds: (A:) Her-1 protein

SCOPe Domain Sequences for d1szha1:

Sequence; same for both SEQRES and ATOM records:

>d1szha1 a.226.1.1 (A:19-164) Her-1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
tltkelikdaaekcctrnrqeccieimkfgtpircgydrdpklpgyvykclqnvlfakep
kkkinlddsvccsvfgndqedsgrrcenrcknlmtspsidaatrldsikscslldnvlyk
cfekcrslrkdgikievlqfeeycea

Timeline for d1szha1:

• d1szha1 first appeared in SCOP 1.69, called d1szha_
  
• d1szha1 appears in SCOPe 2.07