Lineage for d1szeb_ (1sze B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 473648Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 473649Family c.1.4.1: FMN-linked oxidoreductases [51396] (15 proteins)
  6. 473736Protein Flavocytochrome b2, C-terminal domain [51408] (1 species)
  7. 473737Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51409] (10 PDB entries)
    N-terminal domain homologous to cytochrome b5
  8. 473757Domain d1szeb_: 1sze B: [106152]

Details for d1szeb_

PDB Entry: 1sze (more details), 3 Å

PDB Description: L230A mutant flavocytochrome b2 with benzoylformate

SCOP Domain Sequences for d1szeb_:

Sequence, based on SEQRES records: (download)

>d1szeb_ c.1.4.1 (B:) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
getkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhn
ayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqg
vtkvpqmistaascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfv
tvdapslgqrekdmklkfsntkagpkamkktnveesqgasralskfidpsltwkdieelk
kktklpivikgvqrtedvikaaeigvsgvvlsnhggrqldfsrapievlaetmpileqrn
lkdklevfvdggvrrgtdvlkalclgakgvglgrpflyanscygrngvekaieilrdeie
msmrllgvtsiaelkpdlldlstlkartvgvpndvlynevyegptltefeda

Sequence, based on observed residues (ATOM records): (download)

>d1szeb_ c.1.4.1 (B:) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
getkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhn
ayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqg
vtkvpqmistaascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfv
tvdapslgqrekdmklkfalskfidpsltwkdieelkkktklpivikgvqrtedvikaae
igvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlkal
clgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldlst
lkartvgvpndvlynevyegptltefeda

SCOP Domain Coordinates for d1szeb_:

Click to download the PDB-style file with coordinates for d1szeb_.
(The format of our PDB-style files is described here.)

Timeline for d1szeb_: