Lineage for d1szea_ (1sze A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681629Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 681630Family c.1.4.1: FMN-linked oxidoreductases [51396] (18 proteins)
  6. 681745Protein Flavocytochrome b2, C-terminal domain [51408] (1 species)
  7. 681746Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51409] (10 PDB entries)
    N-terminal domain homologous to cytochrome b5
  8. 681765Domain d1szea_: 1sze A: [106151]

Details for d1szea_

PDB Entry: 1sze (more details), 3 Å

PDB Description: l230a mutant flavocytochrome b2 with benzoylformate
PDB Compounds: (A:) Cytochrome b2, mitochondrial

SCOP Domain Sequences for d1szea_:

Sequence, based on SEQRES records: (download)

>d1szea_ c.1.4.1 (A:) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
getkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhn
ayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqg
vtkvpqmistaascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfv
tvdapslgqrekdmklkfsntkagpkamkktnveesqgasralskfidpsltwkdieelk
kktklpivikgvqrtedvikaaeigvsgvvlsnhggrqldfsrapievlaetmpileqrn
lkdklevfvdggvrrgtdvlkalclgakgvglgrpflyanscygrngvekaieilrdeie
msmrllgvtsiaelkpdlldlstlkartvgvpndvlynevyegptltefeda

Sequence, based on observed residues (ATOM records): (download)

>d1szea_ c.1.4.1 (A:) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
getkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhn
ayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqg
vtkvpqmistaascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfv
tvdapslgqrekdmklkfasralskfidpsltwkdieelkkktklpivikgvqrtedvik
aaeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvl
kalclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlld
lstlkartvgvpndvlynevyegptltefeda

SCOP Domain Coordinates for d1szea_:

Click to download the PDB-style file with coordinates for d1szea_.
(The format of our PDB-style files is described here.)

Timeline for d1szea_: