Lineage for d1szda_ (1szd A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483121Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 483122Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 483241Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (5 proteins)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 483260Protein Hst2 [102294] (1 species)
  7. 483261Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102295] (5 PDB entries)
  8. 483263Domain d1szda_: 1szd A: [106150]

Details for d1szda_

PDB Entry: 1szd (more details), 1.5 Å

PDB Description: Structural basis for nicotinamide cleavage and ADP-ribose transfer by NAD+-dependent Sir2 histone/protein deacetylases

SCOP Domain Sequences for d1szda_:

Sequence, based on SEQRES records: (download)

>d1szda_ c.31.1.5 (A:) Hst2 {Baker's yeast (Saccharomyces cerevisiae)}
masmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnlar
lklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqni
dtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgelv
kpaivffgedlpdsfsetwlndsewlrekittsgkhpqqplvivvgtslavypfaslpee
iprkvkrvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekilta

Sequence, based on observed residues (ATOM records): (download)

>d1szda_ c.31.1.5 (A:) Hst2 {Baker's yeast (Saccharomyces cerevisiae)}
masmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnlar
lklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqni
dtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgelv
kpaivffgedlpdsfsetwlndsewlrekittqqplvivvgtslavypfaslpeeiprkv
krvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekilta

SCOP Domain Coordinates for d1szda_:

Click to download the PDB-style file with coordinates for d1szda_.
(The format of our PDB-style files is described here.)

Timeline for d1szda_: