Lineage for d1szca_ (1szc A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694236Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 694237Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 694413Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (7 proteins)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 694437Protein Hst2 [102294] (1 species)
  7. 694438Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102295] (5 PDB entries)
  8. 694441Domain d1szca_: 1szc A: [106149]
    complexed with cl, cna, gol, zn

Details for d1szca_

PDB Entry: 1szc (more details), 1.75 Å

PDB Description: Structural basis for nicotinamide cleavage and ADP-ribose transfer by NAD+-dependent Sir2 histone/protein deacetylases
PDB Compounds: (A:) NAD-dependent deacetylase HST2

SCOP Domain Sequences for d1szca_:

Sequence, based on SEQRES records: (download)

>d1szca_ c.31.1.5 (A:) Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
masmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnlar
lklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqni
dtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgelv
kpaivffgedlpdsfsetwlndsewlrekittsgkhpqqplvivvgtslavypfaslpee
iprkvkrvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekilta

Sequence, based on observed residues (ATOM records): (download)

>d1szca_ c.31.1.5 (A:) Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
masmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnlar
lklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqni
dtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgelv
kpaivffgedlpdsfsetwlndsewlrekittqqplvivvgtslavypfaslpeeiprkv
krvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekilta

SCOP Domain Coordinates for d1szca_:

Click to download the PDB-style file with coordinates for d1szca_.
(The format of our PDB-style files is described here.)

Timeline for d1szca_: