Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 proteins) silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain |
Protein Hst2 [102294] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102295] (5 PDB entries) Uniprot P53686 1-293 |
Domain d1szca1: 1szc A:1-293 [106149] Other proteins in same PDB: d1szca2 complexed with cl, cna, gol, zn |
PDB Entry: 1szc (more details), 1.75 Å
SCOPe Domain Sequences for d1szca1:
Sequence, based on SEQRES records: (download)
>d1szca1 c.31.1.5 (A:1-293) Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} msvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnlarlkl pypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqnidtl erqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgelvkpa ivffgedlpdsfsetwlndsewlrekittsgkhpqqplvivvgtslavypfaslpeeipr kvkrvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekilta
>d1szca1 c.31.1.5 (A:1-293) Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} msvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnlarlkl pypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqnidtl erqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgelvkpa ivffgedlpdsfsetwlndsewlrekittqqplvivvgtslavypfaslpeeiprkvkrv lcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekilta
Timeline for d1szca1: