Lineage for d1szbb2 (1szb B:124-168)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 521093Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 521739Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 521740Family g.3.11.1: EGF-type module [57197] (21 proteins)
  6. 521912Protein Mannose-binding protein associated serine protease 2, MASP2 [90141] (2 species)
    EGF-like domain separates two CUB domains
  7. 521913Species Human (Homo sapiens) [TaxId:9606] [111402] (1 PDB entry)
  8. 521915Domain d1szbb2: 1szb B:124-168 [106148]
    Other proteins in same PDB: d1szba1, d1szbb1

Details for d1szbb2

PDB Entry: 1szb (more details), 2.5 Å

PDB Description: Crystal structure of the human MBL-associated protein 19 (MAp19)

SCOP Domain Sequences for d1szbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szbb2 g.3.11.1 (B:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens)}
idecqvapgeaptcdhhchnhlggfycscragyvlhrnkrtcseq

SCOP Domain Coordinates for d1szbb2:

Click to download the PDB-style file with coordinates for d1szbb2.
(The format of our PDB-style files is described here.)

Timeline for d1szbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1szbb1