![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein Mannose-binding protein associated serine protease 2, MASP2 [90141] (2 species) EGF-like domain separates two CUB domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [111402] (1 PDB entry) Uniprot O00187 17-181 |
![]() | Domain d1szbb2: 1szb B:124-168 [106148] Other proteins in same PDB: d1szba1, d1szbb1 complexed with ca |
PDB Entry: 1szb (more details), 2.5 Å
SCOPe Domain Sequences for d1szbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1szbb2 g.3.11.1 (B:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} idecqvapgeaptcdhhchnhlggfycscragyvlhrnkrtcseq
Timeline for d1szbb2: