Lineage for d1szbb1 (1szb B:3-123)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387375Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2387376Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 2387377Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins)
  6. 2387401Protein Mannose-binding protein associated serine protease 2, MASP2 [89256] (2 species)
    duplication: contains two CUB domains separated by an EGF-like domain
  7. 2387402Species Human (Homo sapiens) [TaxId:9606] [110137] (2 PDB entries)
    Uniprot O00187 17-181
  8. 2387405Domain d1szbb1: 1szb B:3-123 [106147]
    Other proteins in same PDB: d1szba2, d1szbb2
    complexed with ca

Details for d1szbb1

PDB Entry: 1szb (more details), 2.5 Å

PDB Description: Crystal structure of the human MBL-associated protein 19 (MAp19)
PDB Compounds: (B:) mannose binding lectin-associated serine protease-2 related protein, MAp19 (19kDa)

SCOPe Domain Sequences for d1szbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szbb1 b.23.1.1 (B:3-123) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]}
lgpkwpepvfgrlaspgfpgeyandqerrwtltappgyrlrlyfthfdlelshlceydfv
klssgakvlatlcgqestdterapgkdtfyslgsslditfrsdysnekpftgfeafyaae
d

SCOPe Domain Coordinates for d1szbb1:

Click to download the PDB-style file with coordinates for d1szbb1.
(The format of our PDB-style files is described here.)

Timeline for d1szbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1szbb2