Lineage for d1szbb1 (1szb B:3-123)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459594Fold b.23: CUB-like [49853] (2 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 459595Superfamily b.23.1: Spermadhesin, CUB domain [49854] (1 family) (S)
  5. 459596Family b.23.1.1: Spermadhesin, CUB domain [49855] (5 proteins)
  6. 459610Protein Mannose-binding protein associated serine protease 2, MASP2 [89256] (2 species)
    duplication: contains two CUB domains separated by an EGF-like domain
  7. 459611Species Human (Homo sapiens) [TaxId:9606] [110137] (1 PDB entry)
  8. 459613Domain d1szbb1: 1szb B:3-123 [106147]
    Other proteins in same PDB: d1szba2, d1szbb2

Details for d1szbb1

PDB Entry: 1szb (more details), 2.5 Å

PDB Description: Crystal structure of the human MBL-associated protein 19 (MAp19)

SCOP Domain Sequences for d1szbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szbb1 b.23.1.1 (B:3-123) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens)}
lgpkwpepvfgrlaspgfpgeyandqerrwtltappgyrlrlyfthfdlelshlceydfv
klssgakvlatlcgqestdterapgkdtfyslgsslditfrsdysnekpftgfeafyaae
d

SCOP Domain Coordinates for d1szbb1:

Click to download the PDB-style file with coordinates for d1szbb1.
(The format of our PDB-style files is described here.)

Timeline for d1szbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1szbb2