Lineage for d1szba2 (1szb A:124-168)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 889622Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 889623Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 889877Protein Mannose-binding protein associated serine protease 2, MASP2 [90141] (2 species)
    EGF-like domain separates two CUB domains
  7. 889878Species Human (Homo sapiens) [TaxId:9606] [111402] (1 PDB entry)
    Uniprot O00187 17-181
  8. 889879Domain d1szba2: 1szb A:124-168 [106146]
    Other proteins in same PDB: d1szba1, d1szbb1

Details for d1szba2

PDB Entry: 1szb (more details), 2.5 Å

PDB Description: Crystal structure of the human MBL-associated protein 19 (MAp19)
PDB Compounds: (A:) mannose binding lectin-associated serine protease-2 related protein, MAp19 (19kDa)

SCOP Domain Sequences for d1szba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]}
idecqvapgeaptcdhhchnhlggfycscragyvlhrnkrtcseq

SCOP Domain Coordinates for d1szba2:

Click to download the PDB-style file with coordinates for d1szba2.
(The format of our PDB-style files is described here.)

Timeline for d1szba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1szba1