SCOP 1.69: Domain d1szba1: 1szb A:3-123

Lineage for d1szba1 (1szb A:3-123)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.23: CUB-like [49853] (2 superfamilies)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.23.1: Spermadhesin, CUB domain [49854] (1 family)

5. Family b.23.1.1: Spermadhesin, CUB domain [49855] (5 proteins)

6. Protein Mannose-binding protein associated serine protease 2, MASP2 [89256] (2 species)
   duplication: contains two CUB domains separated by an EGF-like domain

7. Species Human (Homo sapiens) [TaxId:9606] [110137] (1 PDB entry)

8. Domain d1szba1: 1szb A:3-123 [106145]
   Other proteins in same PDB: d1szba2, d1szbb2

Details for d1szba1

PDB Entry: 1szb, 2.5 Å

PDB Description: Crystal structure of the human MBL-associated protein 19 (MAp19)

SCOP Domain Sequences for d1szba1:

Sequence; same for both SEQRES and ATOM records:

>d1szba1 b.23.1.1 (A:3-123) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens)}
lgpkwpepvfgrlaspgfpgeyandqerrwtltappgyrlrlyfthfdlelshlceydfv
klssgakvlatlcgqestdterapgkdtfyslgsslditfrsdysnekpftgfeafyaae
d

Timeline for d1szba1:

• d1szba1 is new in SCOP 1.69
  
• d1szba1 appears in SCOP 1.71
  
• d1szba1 appears in the current release, SCOPe 2.08