![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) ![]() |
![]() | Family a.118.9.4: RNA Polymerase II carboxy-terminal domain (CTD)-interacting (CID) domain (RPR domain) [109975] (4 proteins) found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain SMART 00582; Pfam PF04818 |
![]() | Protein PCF11 protein [109976] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109977] (2 PDB entries) Uniprot P39081 1-140 |
![]() | Domain d1szac1: 1sza C:2-140 [106144] Other proteins in same PDB: d1szaa2, d1szab2, d1szac2 |
PDB Entry: 1sza (more details), 2.2 Å
SCOPe Domain Sequences for d1szac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1szac1 a.118.9.4 (C:2-140) PCF11 protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqkl yafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtglp lfegsalekieqflikasa
Timeline for d1szac1:
![]() Domains from other chains: (mouse over for more information) d1szaa1, d1szaa2, d1szab1, d1szab2 |