SCOPe 2.08: Domain d1szac1: 1sza C:2-140

Lineage for d1szac1 (1sza C:2-140)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.4: RNA Polymerase II carboxy-terminal domain (CTD)-interacting (CID) domain (RPR domain) [109975] (4 proteins)
   found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain
   SMART 00582; Pfam PF04818

6. Protein PCF11 protein [109976] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109977] (2 PDB entries)
   Uniprot P39081 1-140

8. Domain d1szac1: 1sza C:2-140 [106144]
   Other proteins in same PDB: d1szaa2, d1szab2, d1szac2

Details for d1szac1

PDB Entry: 1sza, 2.2 Å

PDB Description: the rna polymerase ii ctd in mrna processing: beta-turn recognition and beta-spiral model

PDB Compounds: (C:) PCF11 protein

SCOPe Domain Sequences for d1szac1:

Sequence; same for both SEQRES and ATOM records:

>d1szac1 a.118.9.4 (C:2-140) PCF11 protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqkl
yafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtglp
lfegsalekieqflikasa

Timeline for d1szac1:

• d1szac1 first appeared in SCOP 1.69, called d1szac_
  
• d1szac1 appears in SCOPe 2.07