Lineage for d1szab1 (1sza B:4-140)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007623Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2007694Family a.118.9.4: RNA Polymerase II carboxy-terminal domain (CTD)-interacting (CID) domain (RPR domain) [109975] (4 protein domains)
    found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain
    SMART 00582; Pfam PF04818
  6. 2007695Protein PCF11 protein [109976] (1 species)
  7. 2007696Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109977] (2 PDB entries)
    Uniprot P39081 1-140
  8. 2007698Domain d1szab1: 1sza B:4-140 [106143]
    Other proteins in same PDB: d1szaa2, d1szab2, d1szac2

Details for d1szab1

PDB Entry: 1sza (more details), 2.2 Å

PDB Description: The RNA polymerase II CTD in mRNA processing: beta-turn recognition and beta-spiral model
PDB Compounds: (B:) PCF11 protein

SCOPe Domain Sequences for d1szab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szab1 a.118.9.4 (B:4-140) PCF11 protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqklya
fyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtglplf
egsalekieqflikasa

SCOPe Domain Coordinates for d1szab1:

Click to download the PDB-style file with coordinates for d1szab1.
(The format of our PDB-style files is described here.)

Timeline for d1szab1: