![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) ![]() |
![]() | Family a.118.9.4: RPR domain (SMART 00582 ) [109975] (2 proteins) found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain |
![]() | Protein PCF11 protein [109976] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109977] (2 PDB entries) Uniprot P39081 1-140 |
![]() | Domain d1szaa_: 1sza A: [106142] |
PDB Entry: 1sza (more details), 2.2 Å
SCOPe Domain Sequences for d1szaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1szaa_ a.118.9.4 (A:) PCF11 protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mdhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqk lyafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtgl plfegsalekieqflikasaaale
Timeline for d1szaa_: