Lineage for d1szaa_ (1sza A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1746326Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 1746397Family a.118.9.4: RPR domain (SMART 00582 ) [109975] (2 proteins)
    found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain
  6. 1746398Protein PCF11 protein [109976] (1 species)
  7. 1746399Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109977] (2 PDB entries)
    Uniprot P39081 1-140
  8. 1746400Domain d1szaa_: 1sza A: [106142]

Details for d1szaa_

PDB Entry: 1sza (more details), 2.2 Å

PDB Description: the rna polymerase ii ctd in mrna processing: beta-turn recognition and beta-spiral model
PDB Compounds: (A:) PCF11 protein

SCOPe Domain Sequences for d1szaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szaa_ a.118.9.4 (A:) PCF11 protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqk
lyafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtgl
plfegsalekieqflikasaaale

SCOPe Domain Coordinates for d1szaa_:

Click to download the PDB-style file with coordinates for d1szaa_.
(The format of our PDB-style files is described here.)

Timeline for d1szaa_: