SCOPe 2.04: Domain d1szaa_: 1sza A:

Lineage for d1szaa_ (1sza A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.4: RPR domain (SMART 00582 ) [109975] (2 proteins)
   found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain

6. Protein PCF11 protein [109976] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109977] (2 PDB entries)
   Uniprot P39081 1-140

8. Domain d1szaa_: 1sza A: [106142]

Details for d1szaa_

PDB Entry: 1sza, 2.2 Å

PDB Description: the rna polymerase ii ctd in mrna processing: beta-turn recognition and beta-spiral model

PDB Compounds: (A:) PCF11 protein

SCOPe Domain Sequences for d1szaa_:

Sequence; same for both SEQRES and ATOM records:

>d1szaa_ a.118.9.4 (A:) PCF11 protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqk
lyafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtgl
plfegsalekieqflikasaaale

Timeline for d1szaa_:

• d1szaa_ first appeared in SCOP 1.69
  
• d1szaa_ appears in SCOPe 2.03
  
• d1szaa_ appears in SCOPe 2.05
  
• d1szaa_ appears in the current release, SCOPe 2.08, called d1szaa1