Lineage for d1szaa_ (1sza A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775971Superfamily a.118.9: ENTH/VHS domain [48464] (4 families) (S)
  5. 776030Family a.118.9.4: RPR domain (SMART 00582 ) [109975] (1 protein)
    found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain
  6. 776031Protein PCF11 protein [109976] (1 species)
  7. 776032Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109977] (3 PDB entries)
    Uniprot P39081 1-140
  8. 776033Domain d1szaa_: 1sza A: [106142]

Details for d1szaa_

PDB Entry: 1sza (more details), 2.2 Å

PDB Description: the rna polymerase ii ctd in mrna processing: beta-turn recognition and beta-spiral model
PDB Compounds: (A:) PCF11 protein

SCOP Domain Sequences for d1szaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szaa_ a.118.9.4 (A:) PCF11 protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqk
lyafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtgl
plfegsalekieqflikasaaale

SCOP Domain Coordinates for d1szaa_:

Click to download the PDB-style file with coordinates for d1szaa_.
(The format of our PDB-style files is described here.)

Timeline for d1szaa_: