Class a: All alpha proteins [46456] (218 folds) |
Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.9: ENTH/VHS domain [48464] (4 families) |
Family a.118.9.4: RPR domain (SMART 00582 ) [109975] (1 protein) found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain |
Protein PCF11 protein [109976] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109977] (2 PDB entries) |
Domain d1sz9c_: 1sz9 C: [106141] |
PDB Entry: 1sz9 (more details), 2.1 Å
SCOP Domain Sequences for d1sz9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sz9c_ a.118.9.4 (C:) PCF11 protein {Baker's yeast (Saccharomyces cerevisiae)} dhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqkl yafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtglp lfegsalekieqflikasaa
Timeline for d1sz9c_: