Lineage for d1sz9b_ (1sz9 B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 447406Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 447786Superfamily a.118.9: ENTH/VHS domain [48464] (4 families) (S)
  5. 447845Family a.118.9.4: RPR domain (SMART 00582 ) [109975] (1 protein)
    found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain
  6. 447846Protein PCF11 protein [109976] (1 species)
  7. 447847Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109977] (2 PDB entries)
  8. 447852Domain d1sz9b_: 1sz9 B: [106140]

Details for d1sz9b_

PDB Entry: 1sz9 (more details), 2.1 Å

PDB Description: the rna polymerase ii ctd in mrna processing: beta-turn recognition and beta-spiral model

SCOP Domain Sequences for d1sz9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sz9b_ a.118.9.4 (B:) PCF11 protein {Baker's yeast (Saccharomyces cerevisiae)}
dhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqkl
yafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtglp
lfegsalekieqflikasaaale

SCOP Domain Coordinates for d1sz9b_:

Click to download the PDB-style file with coordinates for d1sz9b_.
(The format of our PDB-style files is described here.)

Timeline for d1sz9b_: