SCOP 1.69: Domain d1sz9b_: 1sz9 B:

Lineage for d1sz9b_ (1sz9 B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (4 families)

5. Family a.118.9.4: RPR domain (SMART 00582 ) [109975] (1 protein)
   found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain

6. Protein PCF11 protein [109976] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109977] (2 PDB entries)

8. Domain d1sz9b_: 1sz9 B: [106140]

Details for d1sz9b_

PDB Entry: 1sz9, 2.1 Å

PDB Description: the rna polymerase ii ctd in mrna processing: beta-turn recognition and beta-spiral model

SCOP Domain Sequences for d1sz9b_:

Sequence; same for both SEQRES and ATOM records:

>d1sz9b_ a.118.9.4 (B:) PCF11 protein {Baker's yeast (Saccharomyces cerevisiae)}
dhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqkl
yafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtglp
lfegsalekieqflikasaaale

Timeline for d1sz9b_:

• d1sz9b_ is new in SCOP 1.69
  
• d1sz9b_ appears in SCOP 1.71
  
• d1sz9b_ appears in the current release, SCOPe 2.08, called d1sz9b1