Lineage for d1sz1b3 (1sz1 B:258-437)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504982Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (2 families) (S)
  5. 504992Family d.58.16.2: Archaeal tRNA CCA-adding enzyme [102995] (1 protein)
    decorated fold with a large insertion
  6. 504993Protein tRNA nucleotidyltransferase, C-terminal domain [102996] (1 species)
  7. 504994Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102997] (10 PDB entries)
  8. 505011Domain d1sz1b3: 1sz1 B:258-437 [106138]
    Other proteins in same PDB: d1sz1a1, d1sz1a2, d1sz1b1, d1sz1b2

Details for d1sz1b3

PDB Entry: 1sz1 (more details), 6.21 Å

PDB Description: Mechanism of CCA-adding enzymes specificity revealed by crystal structures of ternary complexes

SCOP Domain Sequences for d1sz1b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sz1b3 d.58.16.2 (B:258-437) tRNA nucleotidyltransferase, C-terminal domain {Archaeon Archaeoglobus fulgidus}
hpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifeflerenfmplr
safkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpfiengrwwaf
emrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtaelcemmgvkd

SCOP Domain Coordinates for d1sz1b3:

Click to download the PDB-style file with coordinates for d1sz1b3.
(The format of our PDB-style files is described here.)

Timeline for d1sz1b3: