SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1sz1b3 (1sz1 B:258-437)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2176087Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) (S)
  5. 2176103Family d.58.16.2: Archaeal tRNA CCA-adding enzyme [102995] (2 protein domains)
    decorated fold with a large insertion
  6. 2176104Protein tRNA nucleotidyltransferase, C-terminal domain [102996] (1 species)
  7. 2176105Species Archaeoglobus fulgidus [TaxId:2234] [102997] (26 PDB entries)
    Uniprot O28126
  8. 2176138Domain d1sz1b3: 1sz1 B:258-437 [106138]
    Other proteins in same PDB: d1sz1a1, d1sz1a2, d1sz1b1, d1sz1b2
    protein/RNA complex

Details for d1sz1b3

PDB Entry: 1sz1 (more details), 6.21 Å

PDB Description: Mechanism of CCA-adding enzymes specificity revealed by crystal structures of ternary complexes
PDB Compounds: (B:) tRNA nucleotidyltransferase

SCOPe Domain Sequences for d1sz1b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sz1b3 d.58.16.2 (B:258-437) tRNA nucleotidyltransferase, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
hpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifeflerenfmplr
safkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpfiengrwwaf
emrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtaelcemmgvkd

SCOPe Domain Coordinates for d1sz1b3:

Click to download the PDB-style file with coordinates for d1sz1b3.
(The format of our PDB-style files is described here.)

Timeline for d1sz1b3: