Lineage for d1sz1b1 (1sz1 B:143-257)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450031Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 450032Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (3 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 450047Family a.160.1.3: Archaeal tRNA CCA-adding enzyme substrate-binding domain [101274] (1 protein)
  6. 450048Protein tRNA nucleotidyltransferase, second domain [101275] (1 species)
  7. 450049Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [101276] (10 PDB entries)
  8. 450066Domain d1sz1b1: 1sz1 B:143-257 [106136]
    Other proteins in same PDB: d1sz1a2, d1sz1a3, d1sz1b2, d1sz1b3

Details for d1sz1b1

PDB Entry: 1sz1 (more details), 6.21 Å

PDB Description: Mechanism of CCA-adding enzymes specificity revealed by crystal structures of ternary complexes

SCOP Domain Sequences for d1sz1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sz1b1 a.160.1.3 (B:143-257) tRNA nucleotidyltransferase, second domain {Archaeon Archaeoglobus fulgidus}
gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid
vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk

SCOP Domain Coordinates for d1sz1b1:

Click to download the PDB-style file with coordinates for d1sz1b1.
(The format of our PDB-style files is described here.)

Timeline for d1sz1b1: