Lineage for d1sz1a3 (1sz1 A:258-437)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) (S)
  5. Family d.58.16.2: Archaeal tRNA CCA-adding enzyme [102995] (2 proteins)
    decorated fold with a large insertion
  6. Protein tRNA nucleotidyltransferase, C-terminal domain [102996] (1 species)
  7. Species Archaeoglobus fulgidus [TaxId:2234] [102997] (26 PDB entries)
    Uniprot O28126
  8. Domain d1sz1a3: 1sz1 A:258-437 [106135]
    Other proteins in same PDB: d1sz1a1, d1sz1a2, d1sz1b1, d1sz1b2
    protein/RNA complex

Details for d1sz1a3

PDB Entry: 1sz1 (more details), 6.21 Å

PDB Description: Mechanism of CCA-adding enzymes specificity revealed by crystal structures of ternary complexes
PDB Compounds: (A:) tRNA nucleotidyltransferase

SCOPe Domain Sequences for d1sz1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sz1a3 d.58.16.2 (A:258-437) tRNA nucleotidyltransferase, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
hpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifeflerenfmplr
safkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpfiengrwwaf
emrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtaelcemmgvkd

SCOPe Domain Coordinates for d1sz1a3 are not available.

Timeline for d1sz1a3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sz1a1, d1sz1a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1sz1b1, d1sz1b2, d1sz1b3