SCOPe 2.08: Domain d1sz1a3: 1sz1 A:258-437

Lineage for d1sz1a3 (1sz1 A:258-437)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families)

5. Family d.58.16.2: Archaeal tRNA CCA-adding enzyme [102995] (2 proteins)
   decorated fold with a large insertion

6. Protein tRNA nucleotidyltransferase, C-terminal domain [102996] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [102997] (26 PDB entries)
   Uniprot O28126

8. Domain d1sz1a3: 1sz1 A:258-437 [106135]
   Other proteins in same PDB: d1sz1a1, d1sz1a2, d1sz1b1, d1sz1b2
   protein/RNA complex

Details for d1sz1a3

PDB Entry: 1sz1, 6.21 Å

PDB Description: Mechanism of CCA-adding enzymes specificity revealed by crystal structures of ternary complexes

PDB Compounds: (A:) tRNA nucleotidyltransferase

SCOPe Domain Sequences for d1sz1a3:

Sequence; same for both SEQRES and ATOM records:

>d1sz1a3 d.58.16.2 (A:258-437) tRNA nucleotidyltransferase, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
hpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifeflerenfmplr
safkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpfiengrwwaf
emrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtaelcemmgvkd

Timeline for d1sz1a3:

• d1sz1a3 first appeared in SCOP 1.69
  
• d1sz1a3 appears in SCOPe 2.07