![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily) core: 5-helical bundle; up-and-down; right-handed twist |
![]() | Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) ![]() this domain follows the catalytic nucleotidyltransferase domain |
![]() | Family a.160.1.3: Archaeal tRNA CCA-adding enzyme substrate-binding domain [101274] (1 protein) automatically mapped to Pfam PF09249 |
![]() | Protein tRNA nucleotidyltransferase, second domain [101275] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [101276] (26 PDB entries) Uniprot O28126 |
![]() | Domain d1sz1a1: 1sz1 A:143-257 [106133] Other proteins in same PDB: d1sz1a2, d1sz1a3, d1sz1b2, d1sz1b3 protein/RNA complex |
PDB Entry: 1sz1 (more details), 6.21 Å
SCOPe Domain Sequences for d1sz1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sz1a1 a.160.1.3 (A:143-257) tRNA nucleotidyltransferase, second domain {Archaeoglobus fulgidus [TaxId: 2234]} gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk
Timeline for d1sz1a1: