SCOPe 2.08: Domain d1sz1a1: 1sz1 A:143-257

Lineage for d1sz1a1 (1sz1 A:143-257)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.3: Archaeal tRNA CCA-adding enzyme substrate-binding domain [101274] (1 protein)
   automatically mapped to Pfam PF09249

6. Protein tRNA nucleotidyltransferase, second domain [101275] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [101276] (26 PDB entries)
   Uniprot O28126

8. Domain d1sz1a1: 1sz1 A:143-257 [106133]
   Other proteins in same PDB: d1sz1a2, d1sz1a3, d1sz1b2, d1sz1b3
   protein/RNA complex

Details for d1sz1a1

PDB Entry: 1sz1, 6.21 Å

PDB Description: Mechanism of CCA-adding enzymes specificity revealed by crystal structures of ternary complexes

PDB Compounds: (A:) tRNA nucleotidyltransferase

SCOPe Domain Sequences for d1sz1a1:

Sequence; same for both SEQRES and ATOM records:

>d1sz1a1 a.160.1.3 (A:143-257) tRNA nucleotidyltransferase, second domain {Archaeoglobus fulgidus [TaxId: 2234]}
gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid
vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk

Timeline for d1sz1a1:

• d1sz1a1 first appeared in SCOP 1.69
  
• d1sz1a1 appears in SCOPe 2.07