Lineage for d1sz0b2 (1sz0 B:1130-1280)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565235Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
    barrel, partly open; n*=8, S*=10; one psi loop
  4. 565236Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) (S)
  5. 565237Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (2 proteins)
  6. 565246Protein Cation-independent mannose-6-phosphate receptor (MIR-receptor) [63821] (2 species)
  7. 565247Species Cow (Bos taurus) [TaxId:9913] [110283] (3 PDB entries)
  8. 565255Domain d1sz0b2: 1sz0 B:1130-1280 [106131]

Details for d1sz0b2

PDB Entry: 1sz0 (more details), 2.1 Å

PDB Description: n-terminal 3 domains of ci-mpr bound to mannose 6-phosphate

SCOP Domain Sequences for d1sz0b2:

Sequence, based on SEQRES records: (download)

>d1sz0b2 b.64.1.1 (B:1130-1280) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Cow (Bos taurus)}
ankevpcyafdrelkkhdlnpliktsgaylvddsdpdtslfinvcrdievlrasspqvrv
cptgaaaclvrgdrafdvgrpqeglklvsndrlvlsyvkegagqpdfcdghspavtitfv
cpserregtipkltaksncrfeiewvteyac

Sequence, based on observed residues (ATOM records): (download)

>d1sz0b2 b.64.1.1 (B:1130-1280) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Cow (Bos taurus)}
ankevpcyafdrelkkhdlnpliktsgaylvddsdpdtslfinvcrdievlrasspqvrv
cptgaaaclvrgdrafdvgrpqeglklvsndrlvlsyvkpdfcdghspavtitfvcpser
regtipkltaksncrfeiewvteyac

SCOP Domain Coordinates for d1sz0b2:

Click to download the PDB-style file with coordinates for d1sz0b2.
(The format of our PDB-style files is described here.)

Timeline for d1sz0b2: