SCOPe 2.08: Domain d1sz0b2: 1sz0 B:1130-1280

Lineage for d1sz0b2 (1sz0 B:1130-1280)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
   barrel, partly open; n*=8, S*=10; one psi loop

4. Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family)

5. Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins)

6. Protein Cation-independent mannose-6-phosphate receptor (MIR-receptor) [63821] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [110283] (5 PDB entries)
   Uniprot P08169 49-476

8. Domain d1sz0b2: 1sz0 B:1130-1280 [106131]
   complexed with m6p, nag, os

Details for d1sz0b2

PDB Entry: 1sz0, 2.1 Å

PDB Description: n-terminal 3 domains of ci-mpr bound to mannose 6-phosphate

PDB Compounds: (B:) Cation-Independent Mannose 6-phosphate receptor

SCOPe Domain Sequences for d1sz0b2:

Sequence, based on SEQRES records:

>d1sz0b2 b.64.1.1 (B:1130-1280) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Cow (Bos taurus) [TaxId: 9913]}
ankevpcyafdrelkkhdlnpliktsgaylvddsdpdtslfinvcrdievlrasspqvrv
cptgaaaclvrgdrafdvgrpqeglklvsndrlvlsyvkegagqpdfcdghspavtitfv
cpserregtipkltaksncrfeiewvteyac

Sequence, based on observed residues (ATOM records):

>d1sz0b2 b.64.1.1 (B:1130-1280) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Cow (Bos taurus) [TaxId: 9913]}
ankevpcyafdrelkkhdlnpliktsgaylvddsdpdtslfinvcrdievlrasspqvrv
cptgaaaclvrgdrafdvgrpqeglklvsndrlvlsyvkpdfcdghspavtitfvcpser
regtipkltaksncrfeiewvteyac

Timeline for d1sz0b2:

• d1sz0b2 first appeared in SCOP 1.69
  
• d1sz0b2 appears in SCOPe 2.07