Lineage for d1sz0b1 (1sz0 B:1007-1129)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416653Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
    barrel, partly open; n*=8, S*=10; one psi loop
  4. 2416654Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) (S)
  5. 2416655Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins)
  6. 2416684Protein Cation-independent mannose-6-phosphate receptor (MIR-receptor) [63821] (3 species)
  7. 2416687Species Cow (Bos taurus) [TaxId:9913] [110283] (5 PDB entries)
    Uniprot P08169 49-476
  8. 2416694Domain d1sz0b1: 1sz0 B:1007-1129 [106130]
    complexed with m6p, nag, os

Details for d1sz0b1

PDB Entry: 1sz0 (more details), 2.1 Å

PDB Description: n-terminal 3 domains of ci-mpr bound to mannose 6-phosphate
PDB Compounds: (B:) Cation-Independent Mannose 6-phosphate receptor

SCOPe Domain Sequences for d1sz0b1:

Sequence, based on SEQRES records: (download)

>d1sz0b1 b.64.1.1 (B:1007-1129) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Cow (Bos taurus) [TaxId: 9913]}
aefpelcsytweavdtknnmlykinicgnmgvaqcgpssavcmhdlktdsfhsvgdsllk
tasrsllefnttvnckqqnhkiqssitflcgktlgtpefvtatdcvhyfewrttaackkn
ifk

Sequence, based on observed residues (ATOM records): (download)

>d1sz0b1 b.64.1.1 (B:1007-1129) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Cow (Bos taurus) [TaxId: 9913]}
aefpelcsytweavdtknnmlykinicgnmgvaqcgpssavcmhdlktdsfhsvgdsllk
tasrsllefnttvnckkiqssitflcgktlgtpefvtatdcvhyfewrttaackknifk

SCOPe Domain Coordinates for d1sz0b1:

Click to download the PDB-style file with coordinates for d1sz0b1.
(The format of our PDB-style files is described here.)

Timeline for d1sz0b1: