SCOP 1.75: Domain d1syya_: 1syy A:

Lineage for d1syya_ (1syy A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (9 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (9 species)

7. Species Chlamydia trachomatis [TaxId:813] [109786] (1 PDB entry)
   Uniprot O84835

8. Domain d1syya_: 1syy A: [106126]
   complexed with fe, pb

Details for d1syya_

PDB Entry: 1syy, 1.7 Å

PDB Description: crystal structure of the r2 subunit of ribonucleotide reductase from chlamydia trachomatis

PDB Compounds: (A:) Ribonucleoside-diphosphate reductase beta chain

SCOP Domain Sequences for d1syya_:

Sequence; same for both SEQRES and ATOM records:

>d1syya_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Chlamydia trachomatis [TaxId: 813]}
qadildgkqkrvnlnskrlvncnqvdvnqlvpikykwawehylngcannwlpteipmgkd
ielwksdrlsederrvillnlgffstaeslvgnnivlaifkhvtnpearqyllrqafeea
vhthtflyiceslgldekeifnayneraaikakddfqmeitgkvldpnfrtdsveglqef
vknlvgyyiimegiffysgfvmilsfhrqnkmigigeqyqyilrdetihlnfgidlingi
keenpeiwtpelqqeivelikravdleieyaqdclprgilglrasmfidyvqhiadrrle
riglkpiyhtknpfpwm

Timeline for d1syya_:

• d1syya_ first appeared in SCOP 1.69
  
• d1syya_ appears in SCOP 1.73
  
• d1syya_ appears in SCOPe 2.01
  
• d1syya_ appears in the current release, SCOPe 2.08