SCOPe 2.08: Domain d1syqa1: 1syq A:1-128

Lineage for d1syqa1 (1syq A:1-128)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein Vinculin [47224] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101111] (16 PDB entries)
   Uniprot P18206 1-257

8. Domain d1syqa1: 1syq A:1-128 [106124]
   Other proteins in same PDB: d1syqa3
   head domain; contains two domains of this fold; complexed with talin fragment, chain B (Uniprot Q9Y490 607-631)

Details for d1syqa1

PDB Entry: 1syq, 2.42 Å

PDB Description: Human vinculin head domain VH1, residues 1-258, in complex with human talin's vinculin binding site 1, residues 607-636

PDB Compounds: (A:) vinculin isoform VCL

SCOPe Domain Sequences for d1syqa1:

Sequence; same for both SEQRES and ATOM records:

>d1syqa1 a.24.9.1 (A:1-128) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
mpvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvaavqaavsnlvrvgke
tvqttedqilkrdmppafikvenactklvqaaqmlqsdpysvpardylidgsrgilsgts
dllltfde

Timeline for d1syqa1:

• d1syqa1 first appeared in SCOP 1.69
  
• d1syqa1 appears in SCOPe 2.07