Lineage for d1syob2 (1syo B:1130-1280)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 468675Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
    barrel, partly open; n*=8, S*=10; one psi loop
  4. 468676Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) (S)
  5. 468677Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (2 proteins)
  6. 468686Protein Cation-independent mannose-6-phosphate receptor (MIR-receptor) [63821] (2 species)
  7. 468687Species Cow (Bos taurus) [TaxId:9913] [110283] (3 PDB entries)
  8. 468701Domain d1syob2: 1syo B:1130-1280 [106122]

Details for d1syob2

PDB Entry: 1syo (more details), 2.2 Å

PDB Description: n-terminal 3 domains of ci-mpr bound to mannose 6-phosphate

SCOP Domain Sequences for d1syob2:

Sequence, based on SEQRES records: (download)

>d1syob2 b.64.1.1 (B:1130-1280) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Cow (Bos taurus)}
ankevpcyafdrelkkhdlnpliktsgaylvddsdpdtslfinvcrdievlrasspqvrv
cptgaaaclvrgdrafdvgrpqeglklvsndrlvlsyvkegagqpdfcdghspavtitfv
cpserregtipkltaksncrfeiewvteyac

Sequence, based on observed residues (ATOM records): (download)

>d1syob2 b.64.1.1 (B:1130-1280) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Cow (Bos taurus)}
ankevpcyafdrelkkhdlnpliktsgaylvddsdpdtslfinvcrdievlrasspqvrv
cptgaaaclvrgdrafdvgrpqeglklvsndrlvlsyvkfcdghspavtitfvcpserre
gtipkltaksncrfeiewvteyac

SCOP Domain Coordinates for d1syob2:

Click to download the PDB-style file with coordinates for d1syob2.
(The format of our PDB-style files is described here.)

Timeline for d1syob2: