SCOP 1.73: Domain d1syoa2: 1syo A:130-280

Lineage for d1syoa2 (1syo A:130-280)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
   barrel, partly open; n*=8, S*=10; one psi loop

4. Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family)

5. Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (2 proteins)

6. Protein Cation-independent mannose-6-phosphate receptor (MIR-receptor) [63821] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [110283] (3 PDB entries)

8. Domain d1syoa2: 1syo A:130-280 [106119]

Details for d1syoa2

PDB Entry: 1syo, 2.2 Å

PDB Description: n-terminal 3 domains of ci-mpr bound to mannose 6-phosphate

PDB Compounds: (A:) Cation-Independent Mannose 6-phosphate receptor

SCOP Domain Sequences for d1syoa2:

Sequence; same for both SEQRES and ATOM records:

>d1syoa2 b.64.1.1 (A:130-280) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Cow (Bos taurus) [TaxId: 9913]}
ankevpcyafdrelkkhdlnpliktsgaylvddsdpdtslfinvcrdievlrasspqvrv
cptgaaaclvrgdrafdvgrpqeglklvsndrlvlsyvkegagqpdfcdghspavtitfv
cpserregtipkltaksncrfeiewvteyac

Timeline for d1syoa2:

• d1syoa2 first appeared in SCOP 1.69
  
• d1syoa2 appears in SCOP 1.71
  
• d1syoa2 appears in SCOP 1.75
  
• d1syoa2 appears in the current release, SCOPe 2.08