Lineage for d1syla_ (1syl A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1809317Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1809467Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1809468Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 1809538Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 1809542Species Escherichia coli [TaxId:562] [51286] (10 PDB entries)
    Uniprot P06968
  8. 1809551Domain d1syla_: 1syl A: [106117]
    complexed with dut, mg, trs; mutant

Details for d1syla_

PDB Entry: 1syl (more details), 1.95 Å

PDB Description: crystal structure of inactive mutant dutpase complexed with substrate dutp
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1syla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1syla_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglinsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedfd

SCOPe Domain Coordinates for d1syla_:

Click to download the PDB-style file with coordinates for d1syla_.
(The format of our PDB-style files is described here.)

Timeline for d1syla_: