SCOPe 2.03: Domain d1syla_: 1syl A:

Lineage for d1syla_ (1syl A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)

7. Species Escherichia coli [TaxId:562] [51286] (10 PDB entries)
   Uniprot P06968

8. Domain d1syla_: 1syl A: [106117]
   complexed with dut, mg, trs; mutant

Details for d1syla_

PDB Entry: 1syl, 1.95 Å

PDB Description: crystal structure of inactive mutant dutpase complexed with substrate dutp

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1syla_:

Sequence; same for both SEQRES and ATOM records:

>d1syla_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglinsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedfd

Timeline for d1syla_:

• d1syla_ first appeared in SCOP 1.69
  
• d1syla_ appears in SCOPe 2.02
  
• d1syla_ appears in SCOPe 2.04
  
• d1syla_ appears in the current release, SCOPe 2.08