Lineage for d1sy6h1 (1sy6 H:9-119)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740220Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (181 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 2740447Domain d1sy6h1: 1sy6 H:9-119 [106113]
    Other proteins in same PDB: d1sy6a1, d1sy6a2, d1sy6h2, d1sy6h3, d1sy6l1, d1sy6l2
    MQ P01750 P01863 # natural chimera

Details for d1sy6h1

PDB Entry: 1sy6 (more details), 2.1 Å

PDB Description: crystal structure of cd3gammaepsilon heterodimer in complex with okt3 fab fragment
PDB Compounds: (H:) OKT3 Fab heavy chain

SCOPe Domain Sequences for d1sy6h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sy6h1 b.1.1.1 (H:9-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
aelarpgasvkmsckasgytftrytmhwvkqrpgqglewigyinpsrgytnynqkfkdka
tlttdkssstaymqlssltsedsavyycaryyddhycldywgqgttltvss

SCOPe Domain Coordinates for d1sy6h1:

Click to download the PDB-style file with coordinates for d1sy6h1.
(The format of our PDB-style files is described here.)

Timeline for d1sy6h1: