SCOPe 2.07: Domain d1sy6a2: 1sy6 A:118-203

Lineage for d1sy6a2 (1sy6 A:118-203)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein CD3 epsilon chain ectodomain fragment [69162] (3 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens) [TaxId:9606] [110051] (2 PDB entries)
   Uniprot P07766 33-123 ! Uniprot P07766 # CD3E_HUMAN T-cell surface glycoprotein CD3 epsilon chain precursor

8. Domain d1sy6a2: 1sy6 A:118-203 [106112]
   Other proteins in same PDB: d1sy6a1, d1sy6h1, d1sy6h2, d1sy6h3, d1sy6l1, d1sy6l2
   MQ P09693 P07766 # artificial chimera

Details for d1sy6a2

PDB Entry: 1sy6, 2.1 Å

PDB Description: crystal structure of cd3gammaepsilon heterodimer in complex with okt3 fab fragment

PDB Compounds: (A:) T-cell surface glycoprotein CD3 gamma/epsilon chain

SCOPe Domain Sequences for d1sy6a2:

Sequence; same for both SEQRES and ATOM records:

>d1sy6a2 b.1.1.4 (A:118-203) CD3 epsilon chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]}
qtpykvsisgttviltcpqypgseilwqhndkniggdeddknigsdedhlslkefseleq
sgyyvcyprgskpedanfylylrarv

Timeline for d1sy6a2:

• d1sy6a2 first appeared in SCOP 1.69
  
• d1sy6a2 appears in SCOPe 2.06
  
• d1sy6a2 appears in the current release, SCOPe 2.08