Lineage for d1sy6a1 (1sy6 A:1-81)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026186Family b.1.1.4: I set domains [49159] (39 protein domains)
  6. 2026220Protein CD3 gamma chain ectodomain fragment [69160] (2 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2026221Species Human (Homo sapiens) [TaxId:9606] [110050] (1 PDB entry)
    Uniprot P09693 # CD3G_HUMAN T-cell surface glycoprotein CD3 gamma chain precursor
  8. 2026222Domain d1sy6a1: 1sy6 A:1-81 [106111]
    Other proteins in same PDB: d1sy6a2, d1sy6h1, d1sy6h2, d1sy6l1, d1sy6l2
    MQ P09693 P07766 # artificial chimera

Details for d1sy6a1

PDB Entry: 1sy6 (more details), 2.1 Å

PDB Description: Crystal Structure of CD3gammaepsilon Heterodimer in Complex with OKT3 Fab Fragment
PDB Compounds: (A:) T-cell surface glycoprotein CD3 gamma/epsilon chain

SCOPe Domain Sequences for d1sy6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sy6a1 b.1.1.4 (A:1-81) CD3 gamma chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]}
qsikgnhlvkvydyqedgsvlltcdaeaknitwfkdgkmigfltedkkkwnlgsnakdpr
gmyqckgsqnkskplqvyyrm

SCOPe Domain Coordinates for d1sy6a1:

Click to download the PDB-style file with coordinates for d1sy6a1.
(The format of our PDB-style files is described here.)

Timeline for d1sy6a1: