Lineage for d1sy2a_ (1sy2 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467811Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 467812Superfamily b.60.1: Lipocalins [50814] (5 families) (S)
    bind hydrophobic ligands in their interior
  5. 467813Family b.60.1.1: Retinol binding protein-like [50815] (18 proteins)
    barrel, closed; n=8, S=12, meander
  6. 467933Protein Nitrophorin 4 [50845] (1 species)
  7. 467934Species Rhodnius prolixus [TaxId:13249] [50846] (18 PDB entries)
  8. 467938Domain d1sy2a_: 1sy2 A: [106109]

Details for d1sy2a_

PDB Entry: 1sy2 (more details), 1 Å

PDB Description: 1.0 a crystal structure of d129a/l130a mutant of nitrophorin 4

SCOP Domain Sequences for d1sy2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sy2a_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkaagdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

SCOP Domain Coordinates for d1sy2a_:

Click to download the PDB-style file with coordinates for d1sy2a_.
(The format of our PDB-style files is described here.)

Timeline for d1sy2a_: