Lineage for d1sy1a_ (1sy1 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2071989Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2071990Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2071991Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2072311Protein Nitrophorin 4 [50845] (1 species)
  7. 2072312Species Rhodnius prolixus [TaxId:13249] [50846] (49 PDB entries)
    Uniprot Q94734 22-205
  8. 2072319Domain d1sy1a_: 1sy1 A: [106108]
    complexed with hem, no, po4; mutant

Details for d1sy1a_

PDB Entry: 1sy1 (more details), 1.01 Å

PDB Description: 1.0 a crystal structure of t121v mutant of nitrophorin 4 complexed with nitric oxide
PDB Compounds: (A:) Nitrophorin 4

SCOPe Domain Sequences for d1sy1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sy1a_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
vclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

SCOPe Domain Coordinates for d1sy1a_:

Click to download the PDB-style file with coordinates for d1sy1a_.
(The format of our PDB-style files is described here.)

Timeline for d1sy1a_: