Lineage for d1sxya_ (1sxy A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2413761Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2414133Protein Nitrophorin 4 [50845] (1 species)
  7. 2414134Species Rhodnius prolixus [TaxId:13249] [50846] (49 PDB entries)
    Uniprot Q94734 22-205
  8. 2414159Domain d1sxya_: 1sxy A: [106106]
    complexed with hem, nh4; mutant

Details for d1sxya_

PDB Entry: 1sxy (more details), 1.07 Å

PDB Description: 1.07 a crystal structure of d30n mutant of nitrophorin 4 from rhodnius prolixus
PDB Compounds: (A:) Nitrophorin 4

SCOPe Domain Sequences for d1sxya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxya_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}
actknaiaqtgfnkdkyfngdvwyvtdylnlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

SCOPe Domain Coordinates for d1sxya_:

Click to download the PDB-style file with coordinates for d1sxya_.
(The format of our PDB-style files is described here.)

Timeline for d1sxya_: