Lineage for d1sxrb_ (1sxr B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 610138Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 610139Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (1 family) (S)
  5. 610140Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (5 proteins)
    Family 2 zinc amidase;
  6. 610156Protein Peptidoglycan-recognition protein-SA (Cg11709) [111139] (1 species)
  7. 610157Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [111140] (2 PDB entries)
  8. 610159Domain d1sxrb_: 1sxr B: [106102]
    complexed with edo, so4

Details for d1sxrb_

PDB Entry: 1sxr (more details), 1.56 Å

PDB Description: Drosophila Peptidoglycan Recognition Protein (PGRP)-SA

SCOP Domain Sequences for d1sxrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxrb_ d.118.1.1 (B:) Peptidoglycan-recognition protein-SA (Cg11709) {Fruit fly (Drosophila melanogaster)}
cptiklkrqwggkpslglhyqvrpiryvvihhtvtgecsgllkcaeilqnmqayhqneld
fndisynfligndgivyegtgwglrgahtygynaigtgiafignfvdklpsdaalqaakd
llacgvqqgelsedyaliagsqvistqspgltlyneiqewphwlsnphhhhhh

SCOP Domain Coordinates for d1sxrb_:

Click to download the PDB-style file with coordinates for d1sxrb_.
(The format of our PDB-style files is described here.)

Timeline for d1sxrb_: